PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012242-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 693aa    MW: 75871.9 Da    PI: 8.4598
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012242-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.72.4e-33286343260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  NNU_012242-RA 286 DDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSL-DGQITEIVYKGTHNHPK 343
                    8****************************************.***************85 PP

2WRKY39.89e-13459488130
                    ---SS-EEEEEEE--TT-SS-EEEEEE-ST CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsa 30 
                    ldDgy+WrKYGqK+vkg+++pr+   C +a
  NNU_012242-RA 459 LDDGYRWRKYGQKVVKGNPNPRQGAHCVHA 488
                    59*********************9999886 PP

3WRKY53.64.5e-175345722159
                    -EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY  21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     rsYY+Ct agCpv+k+ver+++d ++v++tYeg+Hnh+
  NNU_012242-RA 534 CRSYYKCTNAGCPVRKHVERASHDLRAVITTYEGKHNHD 572
                    6*************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.8E-29276344IPR003657WRKY domain
PROSITE profilePS5081123.858280344IPR003657WRKY domain
SuperFamilySSF1182909.68E-26281344IPR003657WRKY domain
SMARTSM007741.4E-36285343IPR003657WRKY domain
PfamPF031061.1E-25286342IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.5E-34444479IPR003657WRKY domain
SuperFamilySSF1182904.97E-11451500IPR003657WRKY domain
PROSITE profilePS5081131.456454574IPR003657WRKY domain
SMARTSM007741.4E-31459573IPR003657WRKY domain
PfamPF031064.2E-8460488IPR003657WRKY domain
SuperFamilySSF1182901.16E-13533574IPR003657WRKY domain
PfamPF031061.0E-11534572IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.5E-34535574IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 693 aa     Download sequence    Send to blast
KDVTIFHFVS SSSSSNQIRL HRLISPFLHL PPFSLMASSS ASLERSVNSH PTTFSFPNHL  60
MTTSFSDLLT GDDDAHSQKQ DQITVSRGLS DHIADRTGAG VPKFKSIPPP SLPISPPSIS  120
PSSYFAIPPG LSPAELLDSP VLLSASNLLP SPTTGKFLSQ ASNWRNNSFN YQPSVKQEDK  180
NSDFSFQPQT RPAMGSASMF QSSTTTIPKD ENSKGLEQAW NYQEPTKQSG FSSGKSMVKS  240
EFAPLQSFSP EISSIQANAQ NNGGFQSDFN QCPQPSQSLR EQRRSDDGYN WRKYGQKQVK  300
GSENPRSYYK CTYPNCPTKK KVERSLDGQI TEIVYKGTHN HPKPQSTRRS SSSSSCSQQI  360
QPSAAPTLYI PDQSFATRGS SQMESAAATP ENSSISMGDD DFDQTSQMSK SAGDDLEEDE  420
PDAKRWKKEG ENEGISAAGS RTVREPRVVV QTTSDIDILD DGYRWRKYGQ KVVKGNPNPR  480
QGAHCVHAWV VAAPECILQK SCLVSSRITA NMSSLFETRL ALSKSKPFVW LLVCRSYYKC  540
TNAGCPVRKH VERASHDLRA VITTYEGKHN HDVPAARGSS SHSSITRPSS SSDNNSAGAT  600
MAIRPTATAR PSTNINQNSS SSTNPLHSSQ GQAQTPFTLE MLQSPSSFGF SGFGNSMSMA  660
SSYMNQSQQS DTVFSSRAKE EPRDDLFLES LLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-162865741574WRKY transcription factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264512.10.0PREDICTED: probable WRKY transcription factor 25
TrEMBLB2G2840.0B2G284_9R
STRINGVIT_06s0004g07500.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.14e-74WRKY DNA-binding protein 33